SCOPe 2.04: Domain d2zyaa1: 2zya A:2-176

Lineage for d2zyaa1 (2zya A:2-176)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries)

8. Domain d2zyaa1: 2zya A:2-176 [208004]
   Other proteins in same PDB: d2zyaa2, d2zyab2
   automated match to d1pgja2
   complexed with 6pg

Details for d2zyaa1

PDB Entry: 2zya, 1.6 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyaa1:

Sequence; same for both SEQRES and ATOM records:

>d2zyaa1 c.2.1.0 (A:2-176) automated matches {Escherichia coli K-12 [TaxId: 83333]}
skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv
esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad

Timeline for d2zyaa1:

• d2zyaa1 first appeared in SCOPe 2.03
  
• d2zyaa1 appears in SCOPe 2.05
  
• d2zyaa1 appears in the current release, SCOPe 2.08