Lineage for d2zyaa1 (2zya A:2-176)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350446Species Escherichia coli [TaxId:83333] [225273] (5 PDB entries)
  8. 1350455Domain d2zyaa1: 2zya A:2-176 [208004]
    Other proteins in same PDB: d2zyaa2, d2zyab2
    automated match to d1pgja2
    complexed with 6pg

Details for d2zyaa1

PDB Entry: 2zya (more details), 1.6 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zyaa1 c.2.1.0 (A:2-176) automated matches {Escherichia coli [TaxId: 83333]}
skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv
esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad

SCOPe Domain Coordinates for d2zyaa1:

Click to download the PDB-style file with coordinates for d2zyaa1.
(The format of our PDB-style files is described here.)

Timeline for d2zyaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zyaa2