SCOPe 2.08: Domain d2zy9b3: 2zy9 B:276-448

Lineage for d2zy9b3 (2zy9 B:276-448)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.57: MgtE membrane domain-like [161092] (1 superfamily)
   5 transmembrane helices; bundle, right-handed twist

4. Superfamily f.57.1: MgtE membrane domain-like [161093] (1 family)
   homodimer, swapped with the N-terminal helices

5. Family f.57.1.1: MgtE membrane domain-like [161094] (1 protein)
   Pfam PF01769; Divalent cation transporter

6. Protein Mg2+ transporter MgtE [161095] (1 species)

7. Species Thermus thermophilus [TaxId:274] [161096] (2 PDB entries)
   Uniprot Q5SMG8 276-448

8. Domain d2zy9b3: 2zy9 B:276-448 [208003]
   Other proteins in same PDB: d2zy9a1, d2zy9a2, d2zy9b1, d2zy9b2
   automated match to d2yvxa3
   complexed with mg

Details for d2zy9b3

PDB Entry: 2zy9, 2.94 Å

PDB Description: improved crystal structure of magnesium transporter mgte

PDB Compounds: (B:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2zy9b3:

Sequence; same for both SEQRES and ATOM records:

>d2zy9b3 f.57.1.1 (B:276-448) Mg2+ transporter MgtE {Thermus thermophilus [TaxId: 274]}
agpvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsa
tliiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslv
livffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllle

Timeline for d2zy9b3:

• d2zy9b3 first appeared in SCOPe 2.03
  
• d2zy9b3 appears in SCOPe 2.07