SCOPe 2.06: Domain d2zy9b1: 2zy9 B:20-131

Lineage for d2zy9b1 (2zy9 B:20-131)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families)
   made of short helices; approximately 2.5 helices per turn of superhelix
   automatically mapped to Pfam PF03448

5. Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein)
   Pfam PF03448

6. Protein Magnesium transporter MgtE [158793] (2 species)

7. Species Thermus thermophilus [TaxId:274] [158795] (2 PDB entries)
   Uniprot Q5SMG8 7-131

8. Domain d2zy9b1: 2zy9 B:20-131 [208001]
   Other proteins in same PDB: d2zy9a2, d2zy9a3, d2zy9b2, d2zy9b3
   automated match to d2yvxa1
   complexed with mg

Details for d2zy9b1

PDB Entry: 2zy9, 2.94 Å

PDB Description: improved crystal structure of magnesium transporter mgte

PDB Compounds: (B:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2zy9b1:

Sequence; same for both SEQRES and ATOM records:

>d2zy9b1 a.118.26.1 (B:20-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
alrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlspeeqaeylktlppw
rlreileelslddladalqavrkedpayfqrlkdlldprtraevealaryee

Timeline for d2zy9b1:

• d2zy9b1 first appeared in SCOPe 2.03
  
• d2zy9b1 appears in SCOPe 2.05
  
• d2zy9b1 appears in SCOPe 2.07
  
• d2zy9b1 appears in the current release, SCOPe 2.08