![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) ![]() made of short helices; approximately 2.5 helices per turn of superhelix automatically mapped to Pfam PF03448 |
![]() | Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein) Pfam PF03448 |
![]() | Protein Magnesium transporter MgtE [158793] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158795] (2 PDB entries) Uniprot Q5SMG8 7-131 |
![]() | Domain d2zy9b1: 2zy9 B:20-131 [208001] Other proteins in same PDB: d2zy9a2, d2zy9a3, d2zy9b2, d2zy9b3 automated match to d2yvxa1 complexed with mg |
PDB Entry: 2zy9 (more details), 2.94 Å
SCOPe Domain Sequences for d2zy9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zy9b1 a.118.26.1 (B:20-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} alrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlspeeqaeylktlppw rlreileelslddladalqavrkedpayfqrlkdlldprtraevealaryee
Timeline for d2zy9b1: