SCOP 1.73: Domain d1bqhb_: 1bqh B:

Lineage for d1bqhb_ (1bqh B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1bqhb_: 1bqh B: [20800]
   Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhd1, d1bqhd2, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_

Details for d1bqhb_

PDB Entry: 1bqh, 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

PDB Compounds: (B:) protein (beta-2-microglobulin )

SCOP Domain Sequences for d1bqhb_:

Sequence; same for both SEQRES and ATOM records:

>d1bqhb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1bqhb_:

• d1bqhb_ first appeared (with stable ids) in SCOP 1.55, called d1bqhb1
  
• d1bqhb_ appears in SCOP 1.71
  
• d1bqhb_ appears in SCOP 1.75
  
• d1bqhb_ appears in the current release, SCOPe 2.08