SCOPe 2.08: Domain d2zy9a2: 2zy9 A:132-275

Lineage for d2zy9a2 (2zy9 A:132-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Magnesium transporter MgtE [160163] (2 species)

7. Species Thermus thermophilus [TaxId:274] [160164] (2 PDB entries)
   Uniprot Q5SMG8 132-275

8. Domain d2zy9a2: 2zy9 A:132-275 [207999]
   Other proteins in same PDB: d2zy9a1, d2zy9a3, d2zy9b1, d2zy9b3
   automated match to d2yvxa2
   complexed with mg

Details for d2zy9a2

PDB Entry: 2zy9, 2.94 Å

PDB Description: improved crystal structure of magnesium transporter mgte

PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2zy9a2:

Sequence; same for both SEQRES and ATOM records:

>d2zy9a2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv
adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv
leaeatedihklgavdvpdlvyse

Timeline for d2zy9a2:

• d2zy9a2 first appeared in SCOPe 2.03
  
• d2zy9a2 appears in SCOPe 2.07