Lineage for d2zy9a1 (2zy9 A:23-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727528Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) (S)
    made of short helices; approximately 2.5 helices per turn of superhelix
    automatically mapped to Pfam PF03448
  5. 2727529Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein)
    Pfam PF03448
  6. 2727530Protein Magnesium transporter MgtE [158793] (2 species)
  7. 2727534Species Thermus thermophilus [TaxId:274] [158795] (2 PDB entries)
    Uniprot Q5SMG8 7-131
  8. 2727535Domain d2zy9a1: 2zy9 A:23-131 [207998]
    Other proteins in same PDB: d2zy9a2, d2zy9a3, d2zy9b2, d2zy9b3
    automated match to d2yvxa1
    complexed with mg

Details for d2zy9a1

PDB Entry: 2zy9 (more details), 2.94 Å

PDB Description: improved crystal structure of magnesium transporter mgte
PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2zy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zy9a1 a.118.26.1 (A:23-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
evleeihpqdllalwdelkgehryvvltllpkakaaevlshlspeeqaeylktlppwrlr
eileelslddladalqavrkedpayfqrlkdlldprtraevealaryee

SCOPe Domain Coordinates for d2zy9a1:

Click to download the PDB-style file with coordinates for d2zy9a1.
(The format of our PDB-style files is described here.)

Timeline for d2zy9a1: