SCOPe 2.06: Domain d2zxja_: 2zxj A:

Lineage for d2zxja_ (2zxj A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (17 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225593] (4 PDB entries)

8. Domain d2zxja_: 2zxj A: [207996]
   automated match to d1gxqa_

Details for d2zxja_

PDB Entry: 2zxj, 1.87 Å

PDB Description: Crystal structure of YycF DNA-binding domain from Staphylococcus aureus

PDB Compounds: (A:) Transcriptional regulatory protein walR

SCOPe Domain Sequences for d2zxja_:

Sequence; same for both SEQRES and ATOM records:

>d2zxja_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh

Timeline for d2zxja_:

• d2zxja_ first appeared in SCOPe 2.03
  
• d2zxja_ appears in SCOPe 2.05
  
• d2zxja_ appears in SCOPe 2.07
  
• d2zxja_ appears in the current release, SCOPe 2.08