Lineage for d2zv8a1 (2zv8 A:239-501)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223590Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries)
  8. 2223610Domain d2zv8a1: 2zv8 A:239-501 [207991]
    Other proteins in same PDB: d2zv8a2
    automated match to d2etmb_
    complexed with anp

Details for d2zv8a1

PDB Entry: 2zv8 (more details), 2.7 Å

PDB Description: Lyn Tyrosine Kinase Domain-AMP-PNP complex
PDB Compounds: (A:) tyrosine-protein kinase lyn

SCOPe Domain Sequences for d2zv8a1:

Sequence, based on SEQRES records: (download)

>d2zv8a1 d.144.1.0 (A:239-501) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq
hdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmayi
erknyihrdlraanvlvseslmckiadfglarviedneytaregakfpikwtapeainfg
cftiksnvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkm
cwkekaeerptfdylqsvlddfy

Sequence, based on observed residues (ATOM records): (download)

>d2zv8a1 d.144.1.0 (A:239-501) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq
hdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmayi
erknyihrdlraanvlvseslmckiadfglarviregakfpikwtapeainfgcftiksn
vwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkmcwkekae
erptfdylqsvlddfy

SCOPe Domain Coordinates for d2zv8a1:

Click to download the PDB-style file with coordinates for d2zv8a1.
(The format of our PDB-style files is described here.)

Timeline for d2zv8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zv8a2