Lineage for d2zv8a_ (2zv8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1933553Species Mouse (Mus musculus) [TaxId:10090] [194605] (23 PDB entries)
  8. 1933569Domain d2zv8a_: 2zv8 A: [207991]
    automated match to d2etmb_
    complexed with anp

Details for d2zv8a_

PDB Entry: 2zv8 (more details), 2.7 Å

PDB Description: Lyn Tyrosine Kinase Domain-AMP-PNP complex
PDB Compounds: (A:) tyrosine-protein kinase lyn

SCOPe Domain Sequences for d2zv8a_:

Sequence, based on SEQRES records: (download)

>d2zv8a_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
paweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktl
qhdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmay
ierknyihrdlraanvlvseslmckiadfglarviedneytaregakfpikwtapeainf
gcftiksnvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimk
mcwkekaeerptfdylqsvlddfy

Sequence, based on observed residues (ATOM records): (download)

>d2zv8a_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
paweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktl
qhdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmay
ierknyihrdlraanvlvseslmckiadfglarviregakfpikwtapeainfgcftiks
nvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkmcwkeka
eerptfdylqsvlddfy

SCOPe Domain Coordinates for d2zv8a_:

Click to download the PDB-style file with coordinates for d2zv8a_.
(The format of our PDB-style files is described here.)

Timeline for d2zv8a_: