Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (31 PDB entries) |
Domain d2zv8a1: 2zv8 A:239-501 [207991] Other proteins in same PDB: d2zv8a2 automated match to d2etmb_ complexed with anp |
PDB Entry: 2zv8 (more details), 2.7 Å
SCOPe Domain Sequences for d2zv8a1:
Sequence, based on SEQRES records: (download)
>d2zv8a1 d.144.1.0 (A:239-501) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq hdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmayi erknyihrdlraanvlvseslmckiadfglarviedneytaregakfpikwtapeainfg cftiksnvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkm cwkekaeerptfdylqsvlddfy
>d2zv8a1 d.144.1.0 (A:239-501) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq hdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmayi erknyihrdlraanvlvseslmckiadfglarviregakfpikwtapeainfgcftiksn vwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkmcwkekae erptfdylqsvlddfy
Timeline for d2zv8a1: