Lineage for d1bqha1 (1bqh A:182-274)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548690Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries)
  8. 548766Domain d1bqha1: 1bqh A:182-274 [20799]
    Other proteins in same PDB: d1bqha2, d1bqhb_, d1bqhd2, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_

Details for d1bqha1

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqha1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1bqha1:

Click to download the PDB-style file with coordinates for d1bqha1.
(The format of our PDB-style files is described here.)

Timeline for d1bqha1: