Lineage for d2zubb2 (2zub B:73-322)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596497Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 1596534Species Sulfolobus solfataricus [TaxId:2287] [225209] (2 PDB entries)
  8. 1596536Domain d2zubb2: 2zub B:73-322 [207989]
    Other proteins in same PDB: d2zuba1, d2zubb1
    automated match to d1pzna2

Details for d2zubb2

PDB Entry: 2zub (more details), 2.9 Å

PDB Description: Left handed RadA
PDB Compounds: (B:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2zubb2:

Sequence, based on SEQRES records: (download)

>d2zubb2 c.37.1.11 (B:73-322) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 2287]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvvdaphlpegevvf
alteegirda

Sequence, based on observed residues (ATOM records): (download)

>d2zubb2 c.37.1.11 (B:73-322) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 2287]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvmhvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirda

SCOPe Domain Coordinates for d2zubb2:

Click to download the PDB-style file with coordinates for d2zubb2.
(The format of our PDB-style files is described here.)

Timeline for d2zubb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zubb1