| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
| Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [225208] (2 PDB entries) |
| Domain d2zubb1: 2zub B:13-72 [207988] Other proteins in same PDB: d2zuba2, d2zubb2 automated match to d1pzna1 |
PDB Entry: 2zub (more details), 2.9 Å
SCOPe Domain Sequences for d2zubb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zubb1 a.60.4.1 (B:13-72) DNA repair protein Rad51, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
tindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldir
Timeline for d2zubb1: