SCOPe 2.03: Domain d2zuba1: 2zub A:13-72

Lineage for d2zuba1 (2zub A:13-72)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [225208] (2 PDB entries)

8. Domain d2zuba1: 2zub A:13-72 [207986]
   Other proteins in same PDB: d2zuba2, d2zubb2
   automated match to d1pzna1

Details for d2zuba1

PDB Entry: 2zub, 2.9 Å

PDB Description: Left handed RadA

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2zuba1:

Sequence; same for both SEQRES and ATOM records:

>d2zuba1 a.60.4.1 (A:13-72) DNA repair protein Rad51, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
tindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldir

Timeline for d2zuba1:

• d2zuba1 is new in SCOPe 2.03-stable
  
• d2zuba1 appears in SCOPe 2.04
  
• d2zuba1 appears in the current release, SCOPe 2.08