Lineage for d2zuad_ (2zua D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518282Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2518316Species Haloarcula quadrata [TaxId:182779] [225752] (1 PDB entry)
  8. 2518320Domain d2zuad_: 2zua D: [207985]
    automated match to d4enoa_

Details for d2zuad_

PDB Entry: 2zua (more details), 2.59 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase from Haloarcula quadrata
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2zuad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zuad_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Haloarcula quadrata [TaxId: 182779]}
sehertfvmvkpdgvqrgligdivsrfedrglkmvggkfmqidqelaeehygehedkpff
dglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesapgtirgdygldlgrnvihgsd
hedeganereielffdedelvdwdqidsswlye

SCOPe Domain Coordinates for d2zuad_:

Click to download the PDB-style file with coordinates for d2zuad_.
(The format of our PDB-style files is described here.)

Timeline for d2zuad_: