![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Initiation factor 4a [52706] (2 species) homologous to UvrB |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries) Uniprot P60842 21-238 4A-I |
![]() | Domain d2zu6c2: 2zu6 C:246-398 [207980] Other proteins in same PDB: d2zu6a3, d2zu6d3 automated match to d1xtia2 protein/RNA complex; complexed with acy, edo |
PDB Entry: 2zu6 (more details), 2.8 Å
SCOPe Domain Sequences for d2zu6c2:
Sequence, based on SEQRES records: (download)
>d2zu6c2 c.37.1.19 (C:246-398) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihrigrggr fgrkgvainmvteedkrtlrdietfyntsieem
>d2zu6c2 c.37.1.19 (C:246-398) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihriggrkg vainmvteedkrtlrdietfyntsieem
Timeline for d2zu6c2: