| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (6 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries) Uniprot P01887 |
| Domain d1fo0l_: 1fo0 L: [20798] Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h1, d1fo0h2 |
PDB Entry: 1fo0 (more details), 2.5 Å
SCOPe Domain Sequences for d1fo0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo0l_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1fo0l_:
View in 3DDomains from other chains: (mouse over for more information) d1fo0a_, d1fo0b_, d1fo0h1, d1fo0h2 |