Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries) |
Domain d1fo0l1: 1fo0 L: [20798] Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2 |
PDB Entry: 1fo0 (more details), 2.5 Å
SCOP Domain Sequences for d1fo0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo0l1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1fo0l1:
View in 3D Domains from other chains: (mouse over for more information) d1fo0a_, d1fo0b_, d1fo0h1, d1fo0h2 |