SCOPe 2.03: Domain d2zu6c1: 2zu6 C:25-239

Lineage for d2zu6c1 (2zu6 C:25-239)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Initiation factor 4a [52706] (2 species)
   homologous to UvrB

7. Species Human (Homo sapiens) [TaxId:9606] [142305] (2 PDB entries)
   Uniprot P60842 21-238
   4A-I

8. Domain d2zu6c1: 2zu6 C:25-239 [207979]
   automated match to d1xtia1
   protein/RNA complex; complexed with acy, edo

Details for d2zu6c1

PDB Entry: 2zu6, 2.8 Å

PDB Description: crystal structure of the eIF4A-PDCD4 complex

PDB Compounds: (C:) Eukaryotic initiation factor 4A-I

SCOPe Domain Sequences for d2zu6c1:

Sequence, based on SEQRES records:

>d2zu6c1 c.37.1.19 (C:25-239) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
snwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgtgkta
tfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnvraev
qklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydifqkln
sntqvvllsatmpsdvlevtkkfmrdpirilvkke

Sequence, based on observed residues (ATOM records):

>d2zu6c1 c.37.1.19 (C:25-239) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
snwneivdsfddmnlsesllrgiyakpsaiqqrailpcikgydviaqaqsgtgktatfai
silqqieldltqalvlaptrelaqqiqkvvmalgchaciggtnvraevqklqmeaphiiv
gtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydifqklnsntqvvllsatm
psdvlevtkkfmrdpirilvkke

Timeline for d2zu6c1:

• d2zu6c1 is new in SCOPe 2.03-stable
  
• d2zu6c1 appears in SCOPe 2.04
  
• d2zu6c1 appears in the current release, SCOPe 2.08