SCOPe 2.06: Domain d2zskb2: 2zsk B:115-226

Lineage for d2zskb2 (2zsk B:115-226)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.0: automated matches [227233] (1 protein)
   not a true family

6. Protein automated matches [226982] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [225544] (1 PDB entry)

8. Domain d2zskb2: 2zsk B:115-226 [207978]
   automated match to d1jfla2

Details for d2zskb2

PDB Entry: 2zsk, 2.55 Å

PDB Description: Crystal structure of PH1733, an aspartate racemase homologue, from Pyrococcus horikoshii OT3

PDB Compounds: (B:) 226aa long hypothetical aspartate racemase

SCOPe Domain Sequences for d2zskb2:

Sequence; same for both SEQRES and ATOM records:

>d2zskb2 c.78.2.0 (B:115-226) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
vrkvlllgtkttmtadfyiktleekglevvvpndeekeelnriifeelafgnlknkewiv
rliekyresegiegvilgctelplaikqgdvsvevfdsaeihmrklielase

Timeline for d2zskb2:

• d2zskb2 first appeared in SCOPe 2.03
  
• d2zskb2 appears in SCOPe 2.05
  
• d2zskb2 appears in SCOPe 2.07
  
• d2zskb2 appears in the current release, SCOPe 2.08