Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) |
Family c.78.2.0: automated matches [227233] (1 protein) not a true family |
Protein automated matches [226982] (3 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [225544] (1 PDB entry) |
Domain d2zska2: 2zsk A:115-226 [207976] automated match to d1jfla2 |
PDB Entry: 2zsk (more details), 2.55 Å
SCOPe Domain Sequences for d2zska2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zska2 c.78.2.0 (A:115-226) automated matches {Pyrococcus horikoshii [TaxId: 70601]} vrkvlllgtkttmtadfyiktleekglevvvpndeekeelnriifeelafgnlknkewiv rliekyresegiegvilgctelplaikqgdvsvevfdsaeihmrklielase
Timeline for d2zska2: