SCOPe 2.05: Domain d2zska1: 2zsk A:1-114

Lineage for d2zska1 (2zsk A:1-114)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.0: automated matches [227233] (1 protein)
   not a true family

6. Protein automated matches [226982] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [225544] (1 PDB entry)

8. Domain d2zska1: 2zsk A:1-114 [207975]
   automated match to d1jfla1

Details for d2zska1

PDB Entry: 2zsk, 2.55 Å

PDB Description: Crystal structure of PH1733, an aspartate racemase homologue, from Pyrococcus horikoshii OT3

PDB Compounds: (A:) 226aa long hypothetical aspartate racemase

SCOPe Domain Sequences for d2zska1:

Sequence; same for both SEQRES and ATOM records:

>d2zska1 c.78.2.0 (A:1-114) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mkkigiiggttpestlyyykkyieisrekfekyfypeliiysinfkeffqnpegwegrkk
ilinaakaleragaeliafaantphlvfddvqrevnvpmvsiidavaeeilkrg

Timeline for d2zska1:

• d2zska1 first appeared in SCOPe 2.03
  
• d2zska1 appears in SCOPe 2.04
  
• d2zska1 appears in SCOPe 2.06
  
• d2zska1 appears in the current release, SCOPe 2.08