Lineage for d2zrma1 (2zrm A:6-270)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112601Protein RecA protein, ATPase-domain [52671] (6 species)
    C-terminal domain is alpha+beta
  7. 2112619Species Mycobacterium smegmatis [TaxId:246196] [224887] (2 PDB entries)
  8. 2112620Domain d2zrma1: 2zrm A:6-270 [207971]
    Other proteins in same PDB: d2zrma2
    automated match to d1ubfa1
    complexed with dtp, gol

Details for d2zrma1

PDB Entry: 2zrm (more details), 2.8 Å

PDB Description: MsRecA dATP form IV
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2zrma1:

Sequence, based on SEQRES records: (download)

>d2zrma1 c.37.1.11 (A:6-270) RecA protein, ATPase-domain {Mycobacterium smegmatis [TaxId: 246196]}
pdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvie
iygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtge
qaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtgaln
nsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdavgnrtr
vkvvknkvsppfkqaefdilygqgi

Sequence, based on observed residues (ATOM records): (download)

>d2zrma1 c.37.1.11 (A:6-270) RecA protein, ATPase-domain {Mycobacterium smegmatis [TaxId: 246196]}
pdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvie
iygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtge
qaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtgaln
nsgttaifinqlretttggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsp
pfkqaefdilygqgi

SCOPe Domain Coordinates for d2zrma1:

Click to download the PDB-style file with coordinates for d2zrma1.
(The format of our PDB-style files is described here.)

Timeline for d2zrma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zrma2