SCOPe 2.07: Domain d1fo0h1: 1fo0 H:182-275

Lineage for d1fo0h1 (1fo0 H:182-275)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d1fo0h1: 1fo0 H:182-275 [20797]
   Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2, d1fo0l_

Details for d1fo0h1

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (H:) protein (allogeneic h-2kb MHC class I molecule)

SCOPe Domain Sequences for d1fo0h1:

Sequence; same for both SEQRES and ATOM records:

>d1fo0h1 b.1.1.2 (H:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwe

Timeline for d1fo0h1:

• d1fo0h1 first appeared (with stable ids) in SCOP 1.55
  
• d1fo0h1 appears in SCOPe 2.06
  
• d1fo0h1 appears in the current release, SCOPe 2.08