Lineage for d1fo0h1 (1fo0 H:182-275)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53093Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)
  8. 53114Domain d1fo0h1: 1fo0 H:182-275 [20797]
    Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2

Details for d1fo0h1

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0h1 b.1.1.2 (H:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwe

SCOP Domain Coordinates for d1fo0h1:

Click to download the PDB-style file with coordinates for d1fo0h1.
(The format of our PDB-style files is described here.)

Timeline for d1fo0h1: