SCOP 1.55: Domain d1fo0h1: 1fo0 H:182-275

Lineage for d1fo0h1 (1fo0 H:182-275)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries)

8. Domain d1fo0h1: 1fo0 H:182-275 [20797]
   Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2

Details for d1fo0h1

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0h1:

Sequence; same for both SEQRES and ATOM records:

>d1fo0h1 b.1.1.2 (H:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwe

Timeline for d1fo0h1:

• d1fo0h1 appears in SCOP 1.57
  
• d1fo0h1 appears in the current release, SCOPe 2.08