SCOPe 2.05: Domain d2zrea2: 2zre A:271-334

Lineage for d2zrea2 (2zre A:271-334)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families)

5. Family d.48.1.0: automated matches [227236] (1 protein)
   not a true family

6. Protein automated matches [226990] (3 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225585] (8 PDB entries)

8. Domain d2zrea2: 2zre A:271-334 [207968]
   Other proteins in same PDB: d2zrea1
   automated match to d1mo3a2
   complexed with ags, gol, mg

Details for d2zrea2

PDB Entry: 2zre, 2.9 Å

PDB Description: msreca q196n atpgs form iv

PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2zrea2:

Sequence; same for both SEQRES and ATOM records:

>d2zrea2 d.48.1.0 (A:271-334) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
igav

Timeline for d2zrea2:

• d2zrea2 first appeared in SCOPe 2.03
  
• d2zrea2 appears in SCOPe 2.04
  
• d2zrea2 appears in SCOPe 2.06
  
• d2zrea2 appears in the current release, SCOPe 2.08