Lineage for d2zrea1 (2zre A:5-270)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112689Protein automated matches [190393] (10 species)
    not a true protein
  7. 2112734Species Mycobacterium smegmatis [TaxId:246196] [225584] (8 PDB entries)
  8. 2112737Domain d2zrea1: 2zre A:5-270 [207967]
    Other proteins in same PDB: d2zrea2
    automated match to d1g18a1
    complexed with ags, gol, mg

Details for d2zrea1

PDB Entry: 2zre (more details), 2.9 Å

PDB Description: MsRecA Q196N ATPgS form IV
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2zrea1:

Sequence, based on SEQRES records: (download)

>d2zrea1 c.37.1.11 (A:5-270) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
apdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvi
eiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtg
eqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtgal
nnsgttaifinnlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdavgnrt
rvkvvknkvsppfkqaefdilygqgi

Sequence, based on observed residues (ATOM records): (download)

>d2zrea1 c.37.1.11 (A:5-270) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
apdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvi
eiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtg
eqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtgal
nnsgttaifinnlretttggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvs
ppfkqaefdilygqgi

SCOPe Domain Coordinates for d2zrea1:

Click to download the PDB-style file with coordinates for d2zrea1.
(The format of our PDB-style files is described here.)

Timeline for d2zrea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zrea2