Lineage for d2zqzf1 (2zqz F:17-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844627Species Lactobacillus casei [TaxId:1582] [51865] (4 PDB entries)
  8. 2844633Domain d2zqzf1: 2zqz F:17-162 [207959]
    Other proteins in same PDB: d2zqza2, d2zqzb2, d2zqzc2, d2zqzd2, d2zqze2, d2zqzf2
    automated match to d1llca1
    complexed with so4

Details for d2zqzf1

PDB Entry: 2zqz (more details), 2.5 Å

PDB Description: R-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei
PDB Compounds: (F:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqzf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqzf1 c.2.1.5 (F:17-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
npvdiltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d2zqzf1:

Click to download the PDB-style file with coordinates for d2zqzf1.
(The format of our PDB-style files is described here.)

Timeline for d2zqzf1: