SCOPe 2.05: Domain d2zqze1: 2zqz E:17-162

Lineage for d2zqze1 (2zqz E:17-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)

8. Domain d2zqze1: 2zqz E:17-162 [207957]
   Other proteins in same PDB: d2zqza2, d2zqzb2, d2zqzc2, d2zqzd2, d2zqze2, d2zqzf2
   automated match to d1llca1
   complexed with so4

Details for d2zqze1

PDB Entry: 2zqz, 2.5 Å

PDB Description: R-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei

PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqze1:

Sequence; same for both SEQRES and ATOM records:

>d2zqze1 c.2.1.5 (E:17-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
npvdiltyatwklsgfpknrvvgsg

Timeline for d2zqze1:

• d2zqze1 first appeared in SCOPe 2.03
  
• d2zqze1 appears in SCOPe 2.04
  
• d2zqze1 appears in SCOPe 2.06
  
• d2zqze1 appears in the current release, SCOPe 2.08