Lineage for d2zqzb2 (2zqz B:163-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2999033Species Lactobacillus casei [TaxId:1582] [56345] (4 PDB entries)
  8. 2999035Domain d2zqzb2: 2zqz B:163-330 [207952]
    Other proteins in same PDB: d2zqza1, d2zqzb1, d2zqzc1, d2zqzd1, d2zqze1, d2zqzf1
    automated match to d1llca2
    complexed with so4

Details for d2zqzb2

PDB Entry: 2zqz (more details), 2.5 Å

PDB Description: R-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqzb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa

SCOPe Domain Coordinates for d2zqzb2:

Click to download the PDB-style file with coordinates for d2zqzb2.
(The format of our PDB-style files is described here.)

Timeline for d2zqzb2: