| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (20 species) |
| Species Lactobacillus casei [TaxId:1582] [56345] (4 PDB entries) |
| Domain d2zqzb2: 2zqz B:163-330 [207952] Other proteins in same PDB: d2zqza1, d2zqzb1, d2zqzc1, d2zqzd1, d2zqze1, d2zqzf1 automated match to d1llca2 complexed with so4 |
PDB Entry: 2zqz (more details), 2.5 Å
SCOPe Domain Sequences for d2zqzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqzb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa
Timeline for d2zqzb2: