Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (20 species) |
Species Lactobacillus casei [TaxId:1582] [56345] (7 PDB entries) |
Domain d2zqyb2: 2zqy B:163-329 [207944] Other proteins in same PDB: d2zqya1, d2zqyb1, d2zqyc1, d2zqyd1 automated match to d1llca2 complexed with no3 |
PDB Entry: 2zqy (more details), 2.6 Å
SCOPe Domain Sequences for d2zqyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqyb2 d.162.1.1 (B:163-329) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf
Timeline for d2zqyb2: