SCOPe 2.05: Domain d1kbgl_: 1kbg L:

Lineage for d1kbgl_ (1kbg L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
   Uniprot P01887

8. Domain d1kbgl_: 1kbg L: [20794]
   Other proteins in same PDB: d1kbgh1, d1kbgh2
   complexed with nag

Details for d1kbgl_

PDB Entry: 1kbg, 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2

PDB Compounds: (L:) protein (beta-2-microglobulin)

SCOPe Domain Sequences for d1kbgl_:

Sequence; same for both SEQRES and ATOM records:

>d1kbgl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1kbgl_:

• d1kbgl_ first appeared (with stable ids) in SCOP 1.55, called d1kbgl1
  
• d1kbgl_ appears in SCOPe 2.04
  
• d1kbgl_ appears in SCOPe 2.06
  
• d1kbgl_ appears in the current release, SCOPe 2.08