Lineage for d1kbgl_ (1kbg L:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784258Domain d1kbgl_: 1kbg L: [20794]
    Other proteins in same PDB: d1kbgh1, d1kbgh2
    complexed with fuc, hgg, nag

Details for d1kbgl_

PDB Entry: 1kbg (more details), 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
PDB Compounds: (L:) protein (beta-2-microglobulin)

SCOP Domain Sequences for d1kbgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbgl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1kbgl_:

Click to download the PDB-style file with coordinates for d1kbgl_.
(The format of our PDB-style files is described here.)

Timeline for d1kbgl_: