SCOP 1.61: Domain d1kbgl1: 1kbg L:

Lineage for d1kbgl1 (1kbg L:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)

8. Domain d1kbgl1: 1kbg L: [20794]
   Other proteins in same PDB: d1kbgh2

Details for d1kbgl1

PDB Entry: 1kbg, 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2

SCOP Domain Sequences for d1kbgl1:

Sequence; same for both SEQRES and ATOM records:

>d1kbgl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1kbgl1:

• d1kbgl1 first appeared (with stable ids) in SCOP 1.55
  
• d1kbgl1 appears in SCOP 1.59
  
• d1kbgl1 is called d1kbgl_ in SCOP 1.63
  
• d1kbgl1 appears in the current release, SCOPe 2.08, called d1kbgl_