Lineage for d2zqta1 (2zqt A:6-37)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811244Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2811278Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 2811279Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries)
  8. 2811281Domain d2zqta1: 2zqt A:6-37 [207935]
    Other proteins in same PDB: d2zqta2
    automated match to d1f8ab1
    complexed with 1pg, so4; mutant

Details for d2zqta1

PDB Entry: 2zqt (more details), 1.46 Å

PDB Description: crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2zqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqta1 b.72.1.1 (A:6-37) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekrmsrssgrvyyfnhitnasqwerp

SCOPe Domain Coordinates for d2zqta1:

Click to download the PDB-style file with coordinates for d2zqta1.
(The format of our PDB-style files is described here.)

Timeline for d2zqta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zqta2