| Class b: All beta proteins [48724] (180 folds) |
| Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) ![]() |
| Family b.72.1.1: WW domain [51046] (13 proteins) |
| Protein Mitotic rotamase PIN1 [51047] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries) |
| Domain d2zqsa1: 2zqs A:6-37 [207933] Other proteins in same PDB: d2zqsa2 automated match to d1f8ab1 complexed with 1pg, so4; mutant |
PDB Entry: 2zqs (more details), 1.9 Å
SCOPe Domain Sequences for d2zqsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqsa1 b.72.1.1 (A:6-37) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekrmsrssgrvyyfnhitnasqwerp
Timeline for d2zqsa1: