Lineage for d2zo6a_ (2zo6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940994Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries)
  8. 2940996Domain d2zo6a_: 2zo6 A: [207932]
    automated match to d3svnd_

Details for d2zo6a_

PDB Entry: 2zo6 (more details), 1.4 Å

PDB Description: Crystal Structure of Kusabira-Cyan (KCY), a Cyan-Emitting GFP-Like Protein
PDB Compounds: (A:) Cyan-emitting GFP-like protein, Kusabira-Cyan (KCy)

SCOPe Domain Sequences for d2zo6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zo6a_ d.22.1.0 (A:) automated matches {Fungia concinna [TaxId: 496660]}
msvikpemkmkyfmdgsvngheftvegegtgkpyegkhkitldvtkggplpfafdllstv
fsygnrcltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehksti
egtfpdsspiaqnktlgwepstekmtvrdgsmkgddaaylklvgggnhkcyftttytakk
kipnlpqshfighrissvvngtkigvmedaiahlypfn

SCOPe Domain Coordinates for d2zo6a_:

Click to download the PDB-style file with coordinates for d2zo6a_.
(The format of our PDB-style files is described here.)

Timeline for d2zo6a_: