Lineage for d1vacb_ (1vac B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364355Protein beta2-microglobulin [88600] (4 species)
  7. 364479Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)
  8. 364503Domain d1vacb_: 1vac B: [20792]
    Other proteins in same PDB: d1vaca1, d1vaca2

Details for d1vacb_

PDB Entry: 1vac (more details), 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and chicken ovalbumin

SCOP Domain Sequences for d1vacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vacb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1vacb_:

Click to download the PDB-style file with coordinates for d1vacb_.
(The format of our PDB-style files is described here.)

Timeline for d1vacb_: