Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
Protein Putative transcriptional regulator PH1519 [102968] (1 species) archaeal feast/famine regulatory protein |
Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries) identical sequence to Pyrococcus sp. ot3 protein |
Domain d2znyg2: 2zny G:85-170 [207913] Other proteins in same PDB: d2znya1, d2znyb1, d2znyc1, d2znyd1, d2znye1, d2znyf1, d2znyg1, d2znyh1 automated match to d1ri7a2 complexed with arg |
PDB Entry: 2zny (more details), 2.59 Å
SCOPe Domain Sequences for d2znyg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znyg2 d.58.4.2 (G:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]} ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli gsipgvegthtmivlkthkettelpi
Timeline for d2znyg2: