Lineage for d2znyf2 (2zny F:85-170)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556594Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2556599Protein Putative transcriptional regulator PH1519 [102968] (1 species)
    archaeal feast/famine regulatory protein
  7. 2556600Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
    identical sequence to Pyrococcus sp. ot3 protein
  8. 2556616Domain d2znyf2: 2zny F:85-170 [207911]
    Other proteins in same PDB: d2znya1, d2znyb1, d2znyc1, d2znyd1, d2znye1, d2znyf1, d2znyg1, d2znyh1
    automated match to d1ri7a2
    complexed with arg

Details for d2znyf2

PDB Entry: 2zny (more details), 2.59 Å

PDB Description: Crystal structure of the FFRP
PDB Compounds: (F:) Uncharacterized HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2znyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znyf2 d.58.4.2 (F:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

SCOPe Domain Coordinates for d2znyf2:

Click to download the PDB-style file with coordinates for d2znyf2.
(The format of our PDB-style files is described here.)

Timeline for d2znyf2: