SCOPe 2.08: Domain d1vaca1: 1vac A:182-274

Lineage for d1vaca1 (1vac A:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d1vaca1: 1vac A:182-274 [20791]
   Other proteins in same PDB: d1vaca2, d1vacb_

Details for d1vaca1

PDB Entry: 1vac, 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and chicken ovalbumin

PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d1vaca1:

Sequence; same for both SEQRES and ATOM records:

>d1vaca1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1vaca1:

• d1vaca1 first appeared (with stable ids) in SCOP 1.55
  
• d1vaca1 appears in SCOPe 2.07