SCOPe 2.05: Domain d2znya2: 2zny A:85-170

Lineage for d2znya2 (2zny A:85-170)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
   octamer: tetramer of dimers
   automatically mapped to Pfam PF01037

6. Protein Putative transcriptional regulator PH1519 [102968] (1 species)
   archaeal feast/famine regulatory protein

7. Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
   identical sequence to Pyrococcus sp. ot3 protein

8. Domain d2znya2: 2zny A:85-170 [207901]
   Other proteins in same PDB: d2znya1, d2znyb1, d2znyc1, d2znyd1, d2znye1, d2znyf1, d2znyg1, d2znyh1
   automated match to d1ri7a2
   complexed with arg

Details for d2znya2

PDB Entry: 2zny, 2.59 Å

PDB Description: Crystal structure of the FFRP

PDB Compounds: (A:) Uncharacterized HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2znya2:

Sequence; same for both SEQRES and ATOM records:

>d2znya2 d.58.4.2 (A:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

Timeline for d2znya2:

• d2znya2 first appeared in SCOPe 2.03
  
• d2znya2 appears in SCOPe 2.04
  
• d2znya2 appears in SCOPe 2.06
  
• d2znya2 appears in the current release, SCOPe 2.08