SCOPe 2.03: Domain d2znxb1: 2znx B:1-106

Lineage for d2znxb1 (2znx B:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d2znxb1: 2znx B:1-106 [207896]
   Other proteins in same PDB: d2znxy_, d2znxz_
   automated match to d1h8na1
   complexed with 1pg

Details for d2znxb1

PDB Entry: 2znx, 2.3 Å

PDB Description: 5-fluorotryptophan incorporated scfv10 complexed to hen egg lysozyme

PDB Compounds: (B:) ScFv

SCOPe Domain Sequences for d2znxb1:

Sequence; same for both SEQRES and ATOM records:

>d2znxb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtklei

Timeline for d2znxb1:

• d2znxb1 is new in SCOPe 2.03-stable
  
• d2znxb1 appears in SCOPe 2.04
  
• d2znxb1 appears in the current release, SCOPe 2.08