Lineage for d2znxb1 (2znx B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757246Domain d2znxb1: 2znx B:1-106 [207896]
    Other proteins in same PDB: d2znxa3, d2znxb3, d2znxy_, d2znxz_
    automated match to d1h8na1
    complexed with 1pg

Details for d2znxb1

PDB Entry: 2znx (more details), 2.3 Å

PDB Description: 5-fluorotryptophan incorporated scfv10 complexed to hen egg lysozyme
PDB Compounds: (B:) ScFv

SCOPe Domain Sequences for d2znxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znxb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtklei

SCOPe Domain Coordinates for d2znxb1:

Click to download the PDB-style file with coordinates for d2znxb1.
(The format of our PDB-style files is described here.)

Timeline for d2znxb1: