Lineage for d2znxa2 (2znx A:124-234)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367754Domain d2znxa2: 2znx A:124-234 [207895]
    Other proteins in same PDB: d2znxa3, d2znxb3, d2znxy_, d2znxz_
    automated match to d1h8na2
    complexed with 1pg

Details for d2znxa2

PDB Entry: 2znx (more details), 2.3 Å

PDB Description: 5-fluorotryptophan incorporated scfv10 complexed to hen egg lysozyme
PDB Compounds: (A:) ScFv

SCOPe Domain Sequences for d2znxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znxa2 b.1.1.0 (A:124-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyynp
slksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvs

SCOPe Domain Coordinates for d2znxa2:

Click to download the PDB-style file with coordinates for d2znxa2.
(The format of our PDB-style files is described here.)

Timeline for d2znxa2: