SCOPe 2.06: Domain d2znmd_: 2znm D:

Lineage for d2znmd_ (2znm D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries)

8. Domain d2znmd_: 2znm D: [207885]
   automated match to d3a3tf_

Details for d2znmd_

PDB Entry: 2znm, 2.3 Å

PDB Description: Oxidoreductase NmDsbA3 from Neisseria meningitidis

PDB Compounds: (D:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2znmd_:

Sequence; same for both SEQRES and ATOM records:

>d2znmd_ c.47.1.0 (D:) automated matches {Neisseria meningitidis [TaxId: 491]}
ltegedylvldkpipqeqsgkievleffgyfcvhchhfdplllklgkalpsdaylrtehv
vwqpemlglarmaaavnlsglkyqanpavfkavyeqkirlenrsvagkwalsqkgfdgkk
lmraydspeaaaaalkmqklteqyridstptvivggkyrvifnngfdggvhtikelvakv
reer

Timeline for d2znmd_:

• d2znmd_ first appeared in SCOPe 2.03
  
• d2znmd_ appears in SCOPe 2.05
  
• d2znmd_ appears in SCOPe 2.07
  
• d2znmd_ appears in the current release, SCOPe 2.08