| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries) |
| Domain d2znmc_: 2znm C: [207884] automated match to d3a3tf_ |
PDB Entry: 2znm (more details), 2.3 Å
SCOPe Domain Sequences for d2znmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znmc_ c.47.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
ltegedylvldkpipqeqsgkievleffgyfcvhchhfdplllklgkalpsdaylrtehv
vwqpemlglarmaaavnlsglkyqanpavfkavyeqkirlenrsvagkwalsqkgfdgkk
lmraydspeaaaaalkmqklteqyridstptvivggkyrvifnngfdggvhtikelvakv
reerkr
Timeline for d2znmc_: