Lineage for d2znmc_ (2znm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880064Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries)
  8. 2880073Domain d2znmc_: 2znm C: [207884]
    automated match to d3a3tf_

Details for d2znmc_

PDB Entry: 2znm (more details), 2.3 Å

PDB Description: Oxidoreductase NmDsbA3 from Neisseria meningitidis
PDB Compounds: (C:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2znmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znmc_ c.47.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
ltegedylvldkpipqeqsgkievleffgyfcvhchhfdplllklgkalpsdaylrtehv
vwqpemlglarmaaavnlsglkyqanpavfkavyeqkirlenrsvagkwalsqkgfdgkk
lmraydspeaaaaalkmqklteqyridstptvivggkyrvifnngfdggvhtikelvakv
reerkr

SCOPe Domain Coordinates for d2znmc_:

Click to download the PDB-style file with coordinates for d2znmc_.
(The format of our PDB-style files is described here.)

Timeline for d2znmc_: